PathCheck Sensor. 96- or 384-well microplate compatibility. By measuring optical pathlength, it eliminates the last major distinction between microplate readers and spectrophotometers. Each sample has a discrete sample beam and reference beam. Abs 49 sec. SpectraMax M5. Annual recertification of your validation plates ensure that they meet specifications and give you confidence in the performance of your instrument. Learn more about its features, specifications, and applications in this user. Version7. For more information, please visit us at Devices – Spectramax Gemini XS plate reader (Fluorescence) Molecular Devices – Spectramax 384 plus plate reader (UV/VIS) Invitrogen by Life technologies Qubit 2. Microplates for applications that require high sample recovery rates. Light Source: Xenon flash lamp. !Pathchecklm1000. The optical system of SpectraMax Plus384 Microplate Reader is built around a monochromator, which allows for selection of up to six wavelengths at a time. This reader also makes use of a unique temperature. This user guide provides detailed instructions, troubleshooting tips and technical specifications for these instruments. Detection Cartridge (384) (PN 0200-7015) • SpectraMax Paradigm Glow Luminescence (LUM) Detection Cartridge (96) (PN 0200-7014) A glow luminescence detection cartridge contains the optics and electrical components needed to perform specific measurement modes or for specific applications. Double-click the unknown device with the yellow warning icon. What is the minimum well volume needed to run a 384 well plate? Minimum volume depends on the solution (curved vs. Simplified microplate washing from single-tube dispensing to washing full 96- and 384-well plates. For fluorescence intensity assays, users can select from top- or bottom-read modes for improved sensitivity in solution and cell-based assays. Such cross talk can occur through the wall of a white 384 well microplate. QuickSync. Labsystems Nepheloskan Ascent Microplate Reader. . The SpectraMax® 340 PC 384 Absorbance Microplate Reader from Molecular Devices provides the necessary tools for absorbance measurement in the visible range. The SpectraMax® iD3 Multi-Mode Microplate Reader is the cornerstone of a complete laboratory solution to help you expand the boundaries of your research capabilities. Read one sample or up to 384 in a single plate read using any standard cuvette, 12 x 75 mm test tube, or 96- or 384-well microplate. SpectraMax® Plus 384 provides ultrafast, full spectral range detection for cuvettes, 96-well, and 384-well microplates, with the only temperature-independent method for pathlength correction. Meso Scale Discovery 1250 Sector Imager 2400. The SpectraMax® M Series Multi-Mode Microplate Readers measure UV and visible absorbance, fluorescence, luminescence, fluorescence polarization, TRF and HTRF. Clearance . Detection modalities include absorbance (UV-Vis Abs) and fluorescence intensity (FI) and have optical performance comparable to a top-of-the-line dedicated spectrofluorometer or. SpectraMax ABS Plus reader utilizes Molecular Devices PathCheck Sensor- the only patented technology. Simply select the absorbance maximum of a sample and let the monochromator tune to that exact wavelength. The SpectraMax Vertical 1000 is available for purchase online and comes with a five-year warranty. When reading optical density at wavelengths below 340 nm,. Detection modalities include absorbance (UV-Vis Abs) and fluorescence intensity (FI) and have optical performance comparable to a top-of-the-line dedicated spectrofluorometer or. The user must ensure that the meniscus is comfortably above the light beam in standard cuvettes and that the sample chamber in a microcuvette is aligned properly with the beam. The SpectraMax® Multi-Mode Microplate Reader provide great flexibility and include. spr SpectraMax iD3 SpectraTest ABS2 v1. The SpectraMax Paradigm Multi-Mode Detection. Before you do a bottom read, or use high profile (6-well, 12-well, 24-well, or 48-well) plates, you must remove the plate adapter from the plate drawer. SpectraMax Spectrophotometers for UV-Vis Absorbance Detection. The SpectraMax M2 and M2e systems provide the multi detection microplate readers with dualmonochromators, dual-mode cuvette ports, with top & bottom reading. SoftMax Pro Software, the industry-leading microplate reader software for the SpectraMax Plus 384 system, allows complete customization of data collection and analysis. TheSpectraMax®340PC384,SpectraMax®190,andVersaMax™microplate. Product Specs. 5065390D 3 Contents SafetyInformation 4 Warnings,Cautions,Notes,andTips 4 Chapter1:Introduction 7 ComputerIntegration 8 PlateControls 9 CuvetteChamber 10 Multimode Reader Comparison Chart. The optical system of the SpectraMax 340PC384 Microplate Reader is built around a monochromator, which allows for selection of up to six wavelengths at a time for. , FI 15 sec. TheSpectraMax®Plus384addstheabilitytoread cuvettes. For wavelengths in the UV range above 220 nm,. Combines UV/Vis spectrophotometer and microplate reader. SPECTRAmax PLUS 384 measuring instruments pdf manual download. The SpectraMax ® M3, M4, M5, and M5 e Microplate Readers are a series of dual-monochromator, multidetection, multi-mode instruments with a triple-mode cuvette port and 6-well to 384-well microplate reading capability. The SpectraMax® L Microplate Reader measures flash and glow luminescence assays in both 96- and 384-well plates. The SpectraMax M5e Multi-Mode Microplate Reader features a triple-mode cuvette port, temperature control, microplate shaking, and the industry leading SoftMax Pro. SpectraMax iD3 reader is built on the same foundation that has made our entire SpectraMax microplate reader product line among the most trusted in the industry. SpectraMax and VersaMax Plate Readers OperatorÕs Manual Ñ 0112-0126 Rev A SpectraMax Plus 384 SpectraMax 190 SpectraMax 340PC 384 VersaMax Microplate Spectrophotometer Operator's Manual Molecular Devices Corporation 1311 Orleans Drive Sunnyvale, California 94089 Part # 0112-0126 Rev A. Detection cartridge modularity allows for easy addition of new read modes within minutes without. The PathCheck Sensor is a revolutionary new awardwinning1 technology in SpectraMax® Instruments for measuring the fluid level in every well of a microplate 2–5. Light Source: Xenon flash. Select the Driver tab and click Update Driver. . 315 can't find zero order. If values are present, then. DNA provides the same sensitivity as a spectrophotometer. SpectraMax 340PC 384 and SpectraMax Plus 384 read both 96-and 384-well microplates. SpectraMax® 340PC384 microplate reader provides everything needed to measure absorbance in the visible range, including temperature control, a robotics-compatible interface and SoftMax® Pro data analysis software. Temperature control. SpectraMax® M2 and M2e Microplate Readers are the standard for UV/visible multimode reader absorbance, providing ultrafast and full spectral range detection for cuvettes and 6-, 12-, 24-, 48-, 96-, and 384-well microplates. Spectramax i3 manual. SpectraMax Gemini XPS/EM Register or Sign In. Assay Performance with Various Instrument Settings The SpectraMax® M2/M2e instruments use SoftMaxPro® DataSpectraMax® Microplate Readers and SoftMax® Pro Software. Published Dec 16, 2020 | Updated Dec 16, 2020. For more sample throughput, the system can be. Easy-to-use, robust assay kits for. o SpectraMax M2 - Instrument boot-up problem while connected to SoftMax Pro has been fixed o LMax II - Fast Kinetic read mode button icon is fixed to show the selected state. Features. 2. Reliable performance with a proven track record For nearly 30 years, Molecular Devices has provided scientists with tools to expand the boundaries of their research. Features demonstrated by the model include temperature control, a robot-compatible interface and data analysis software. 305 reference level saturation. Molecular Devices Microplate Reader Spectramax 384 340PC. Typically the system can detect absorbance, luminescence, fluorescence, and even make more specialized fluorescence measurements like time-resolved fluorescence (TRF) and fluorescence polarization (FP). The contents of the wells in a microplate can be mixed automatically by shaking before each read cycle, which makes it possible to perform kinetic analysis of solid-phase, enzyme-mediated reactions (mixing is not critical for liquid-phase reactions). 7. The optical systems use two scanning monochromators soSpectramax Plus 384 Microplate Reader is available from The Lab World Group. Customize data collection and analysis. o SpectraMax M2 - Well Scan read mode - single well read coordinate problem fixed. SpectraMax® Plus 384 provides ultrafast, full spectral range detection for cuvettes, 96-well, and 384-well microplates, with the only temperature-independent method for pathlength correction. Wavelength optimization. SpectraMax® Plus 384 provides ultrafast, full spectral range detection for cuvettes, 96-well, and 384-well microplates, with the only temperature-independent method for pathlength correction. spr SpectraMax iD5 SpectraTest ABS2 v1. The SpectraMax® Plus 384 Microplate Reader from Molecular Devices can run both standard spectrophotometer and microplate reader applications on the same instrument. Shaker time: 0 to 999 seconds Temperature control: Ambient +4°C to 45°C Temperature. plates < 100 amol (384-well) 1. 5 mP 6 mP * For properly functioning, operated, and maintained equipment. Temperature range between 4°C above ambient to 45°C. Biocompare is the leading resource for up-to. The SPECTRAmax™ 340PC 384 microplate spectrophotometer provides rapid and sensitive measurements of a variety of analytes across a wide range of concentrations. Monochromator wavelength selection saves you the time and trouble of ever having to. The Molecular Devices SpectraMax 384 is a UV/Vis spectrophotometer and microplate reader combination for more reliable and fast data reporting with built-in cuvette port and microplate drawer. SpectraMax 340PC 384 and SpectraMax Plus 384 read both 96-and 384-well microplates. By using PathCheck, SpectraMax readers can automatically normalize sample absorbance values to a 1-cm pathlength and calculate the concentrations. Robust. 76358-624. In addition, the iD5 reader measures TRF and FP and can be expanded to include TR-FRET, HTRF®, BRET, dual luciferase reporter assays with injectors, and western blot detection. selected when SpectraMax Plus 384 was selected in the Preferences dialog. Keywords: spectramax m2 systems, spectramax m2e systems, spectramax m2/m2e readers, pathcheck sensor, spectratest abs1 absorbance, stakmax stacker Created Date: 5/20/2019 9:24:38 AM SpectraMax 340PC 384 and SpectraMax Plus 384 read both 96-and 384-well microplates. 0nm incrementsThe SPECTRAmax™ plus 384 microplate spectrophotometer provides rapid UV/VIS measurements of a variety of analytes. SpectraDrop Micro-Volume Refills, 24-Well Bottom Slides. Light Source: Xenon flash lamp. Products : SpectraMax Plus 384 reader, SpectraMax 190 reader, SpectraMax 340PC 384 (Obsolete), SpectraMax 250 (Obsolete), SpectraMax 340 (Obsolete), VersaMax reader How does stray light affect my OD reading? The basic problem caused by stray light (light you don't want, getting into the read) is a falsely low OD seen. SpectraMax® Plus 384 provides ultrafast, full spectral range detection for cuvettes, 96-well, and 384-well microplates, with the only temperature-independent method for pathlength. Description Control Panel Cuvette Chamber Back Panel Microplate Drawer The Control Panel TEMP on/off TEMP Figure 1. Theseinstrumentsmeasuretheopticaldensity(OD)ofsamplesatselectedwavelengthsina singlereadmode. 96 / 384 Head: Fixed Pin Tool - 384 Head: Grippable Pin Tool - 96 / 384 Head: Magnetic Pin Tool - 96 / 384 / 1536 Head: LUMINESCENCE MICROPLATE. The reader is ideal for measuring flash and glow assays, including dual luciferase reporter gene, G protein-coupled receptor (GPCR) via aequorin, bioluminescence resonance energy transfer (BRET), and acridinium ester flash assays, in both 96- and 384-well plates. The SpectraMax Plus 384 Microplate Reader from Molecular Devices can run both standard spectrophotometer and microplate reader applications on the same instrument. SpectraMax M3, M4, M5, and M5e Microplate Reader User Guide Plate Adapter Before you read standard 96-well or 384-well plates from the top, you must insert the plate adapter in the plate drawer. ester flash assays, in both 96- and 384-well plates. 190-1000 nm, tunable in 1 nm increments. AlphaScreen and AlphaLisa detection using a 680 nm excitation laser diode and a 570/100 nm emission filter. Alpha 384 STD 96- and 384-well . 1. 96, 384 wells Light source Xenon flash lamp (1 joule/flash) Detector Photomultiplier tube (PMT) Read time** 96 wells: 384 wells: Abs 18 sec. Hybrid optical system on the SpectraMax iD5 reader. SpectraMax® Plus 384 provides ultrafast, full spectral range detection for cuvettes, 96-well, and 384-well microplates, with the only temperature-independent method for pathlength correction. 1) All parts of the SPECTRAmax PLUS 384 Microplate Spectrophotometer are warranted for a period of one (1) year from the original date of delivery. Browse for different fluorescent readers below and compare across different instrument suppliers. Detection modalities include absorbance (UV-Vis Abs) and fluorescence intensity (FI). SPECTRAmax PLUS Microplate Spectrophotometer Operator’s Manual 1-3 Introduction General Overview The SPECTRAmax™ PLUS microplate spectrophotometer provides rapid and sensitive UV/VIS measurements of a variety of analytes including specific pro-teins, nucleic acids, and other molecules across a wide range of concentrations. 012 fmol 0. SpectraMax Plus384, 190, 340PC384, and VersaMax User Guide Molecular Devices User Guide SpectraMax Paradigm Microplate Reader General specifications User-upgradeable Multi-Mode Detection Platform Technical specifications Optimized Guaranteed* Fluorescence Intensity (FI) (Fluorescein) 96-well (200 µL) 0. 4 µL DNA standards. ‘StimB’ is Stimulation Buffer, included in the IP-One Gq kit. For more sample throughput, both readers can be easily SpectraMax i3x Microplate Reader, Molecular Devices (Cat# i3X) 96-well white walled clear bottom plates, Costar (Cat# 3903) Purified luciferase, Promega (Cat# E1701) 384-well solid white plates, Greiner (Cat# 655075) CHO-K1 cells, ATCC (Cat# CCL-61) Complete Growth Media Ham’s F12 Medium, Life Technologies (Cat# 11765-54) SpectraMaxPlus384reads96-wellplates,384-wellplates,andcuvettes. 10822 512. Validating the absorbance optical performance of your microplate reader is as simple as reading a plate. Spectrophotometer 또는 Microplate Reader 상의 260nm에서 측정된 DNA 샘플의 흡광도는…. Or, with the reader specifications noted from the Instrument Description section of your reader's manual, as well as those for your PC, you can calculate needs more closely. Accurate quantitation TheSpectraMax®340PC384,SpectraMax®190,andVersaMax™microplate spectrophotometersproviderapidandsensitivemeasurementsofavarietyofanalytes acrossawiderangeofconcentrations. SpectraMax340PC384reads96-wellplatesand384-wellplates. The contents of the wells in a microplate can be mixed automatically by shaking before each read cycle, which makes it possible to perform kinetic analysis of solid-phase, enzyme-mediated reactions (mixing is not critical for liquid-phase reactions). OurSpectraTest ABS1 User Guide - Molecular DevicesLearn how to use the SpectraTest ABS1 plate to validate the absorbance performance of your microplate reader. Absorbance = E * C * L. The optical system of SpectraMax Plus384 Microplate Reader is built around a monochromator, which allows for selection of up to six wavelengths at a time for absorbance detection in the UV-visible wavelength range (190 nm - 1000 nm). All measures were done in triplicate. Use preconfigured wash, soak, and aspiration protocols or create your own multi-step protocol using the simple touchscreen interface. A preconfigured protocol with optimized reader settings enabled reading of a 384-well plate in just two minutes. Detection modalities are shown in Table 1-1. . The new SPECTRAmax® PLUS 384 is the only spectrophotometer with a built-in cuvette port and microplate drawer. Validate the optical performance of your absorbance . Corning® EcoChoice™ products are produced, packaged, and/or distributed in an environmentally friendly manner following United States Government Federal Trade Commission (FTC) Guidelines Learn More. SUPPORTED PLATES Microplates having 6, 12, 24, 48, 96, and 384 wells can be used in the SpectraMax M2 and SpectraMax M2 . Read one sample or up to 384 in a single plate read using any standard cuvette, 12 x 75 mm test tube, or 96- or 384-well microplate. The excitation and the emission. Three low volume 24-well bottom slides. There were 12 replicate wells per dilution in both 96-well and 384- well plates. For the reference reading, use the “0” standard. Enables data acquisition in endpoint, kinetic, and spectral scan modes at wavelengths across the UV-visible wavelength range, with the only temperature-independent method of pathlength correction. The contents of the wells in a microplate can be mixed automatically by shaking before each read cycle, which makes it possible to perform kinetic analysis of solid-phase, enzyme-mediated reactions (mixing is not critical for liquid-phase reactions). and detection of plate formats from 6- to 384-wells, the SpectraMax iD5 reader is the complete solution for all your research needs. spectramax, i3x, spectramax i3x, detection cartridge, spectramax i3x injector cartridge, smartinject technology, atp a, spectramax i3x multi-mode microplate reader, luminescent cell. The SpectraTest® Validation Plates are valuable tools for verifying that absorbance-, fluorescence-, and luminescence-capable microplate readers are operating correctly for GMP and GLP laboratories. 384-well: Abs 49 sec. microplates or in a cuvette at a selected. SpectraMax Paradigm Microplate Reader General specifications User-upgradeable Multi-Mode Detection Platform Technical specifications Optimized Guaranteed* Fluorescence Intensity (FI) (Fluorescein) 96-well (200 µL) 0. SoftMax® Pro Software for Windows 10 and 11 is designed to provide the simplicity, flexibility and power required for advanced data analysis. For more sample throughput, both readers can be easilySpectraMax i3x Microplate Reader, Molecular Devices (Cat# i3X) 96-well white walled clear bottom plates, Costar (Cat# 3903) Purified luciferase, Promega (Cat# E1701) 384-well solid white plates, Greiner (Cat# 655075) CHO-K1 cells, ATCC (Cat# CCL-61) Complete Growth Media Ham’s F12 Medium, Life Technologies (Cat# 11765-54)SpectraMax190,340PC384,Plus384,VersaMaxMicroplateSpectrophotometersUserGuide 8 0112-0126D ComputerIntegration. Detection modalities are shown in Table 1-1. Manufacturer: Molecular Devices Model: SpectraMax Plus 384 The SpectraMax® Plus 384 Microplate Reader from Molecular Devices can run both standard spectrophotometer and microplate reader applications on the same instrument. SpectraMax® Plus 384 microplate reader can run both standard spectrophotometer and microplate reader applications on the same instrument. Special tubing set, Multidrop (length of tubing 50 - 200 cm in 10 cm increments) The minimum order for this item is . Next generation SpectraMax® absorbance microplate readers. For more sample throughput, the system can be. Avantor is setting science in motion for a better world | Avantor - VWROverview of 384-Well High Sample Recovery Plate. Assay Kits. Also refer to this Multimode Reader Comparison Chart. SpectraMaxPlus384reads96-wellplates,384-wellplates,andcuvettes. FilterMax F3 and F5 Multi-Mode; SpectraMax Paradigm® Multi-Mode. Robust, high-value microplate readers that can run samples based on pre-defined protocols and standard filter modes cover the entire visible range for a variety of assays. 9 in. 384 distinct wells in a source plate to a read plate, simultaneously. Categories:. The SpectraMax® M3 Microplate Reader is the standard for UV/visible multi-mode reader absorbance, providing ultrafast, full spectral range detection for cuvettes and 6-, 12-, 24-, 48-, 96-, and 384-well microplates. Also see:. Perform the following steps to install the drivers: Start > Control Panel > System. SpectraMax i3x Multi-Mode Microplate Reader. Includes: Computer Loaded with SoftMax Pro 5. The SpectraMax i3x reader has variable bandwidth for fluorescence and luminescence, and you are able to choose either 9nm or 15 nm for excitation and either 15 nm or 25 nm for emission. no. Every SpectraMax® 340 PC 384 microplate reader has an optical system built around a monochromator. SpectraMax®Plus384 SpectraMax®190 SpectraMax®340PC384. Read one sample or up to 384 in a single plate read using any standard cuvette, or 96- or 384-well microplate. 5014038F 3 Contents SafetyInformation 5 Warnings,Cautions,Notes,andTips 5 Chapter1:Introduction 11 ComputerIntegration 11 Applications 12 DualPhotomultiplierTubes 12For SpectraMax iD5, i3x, and Mini readers, the read height setting should be optimized for the microplate used. This product is no longer available on Biocompare. SpectraMax® M5e Multi-Mode Microplate Reader performance with an integrated 8- or 16-channel pipettor into one compact benchtop reader. It may be named "Pothos". Normally this fluorometric assay is performed in 96-well microplates. Page 8: Components (enunciator blinks if not at set point). When reading optical density at wavelengths below 340 nm, special UV-transparent, disposable or quartz microplates allowing transmission of the deep UV spectra must be used. </p> <p>Tissue-culture treated microplates are supplied with lids except when supplied in a case of 200 microplates. Microplates having 6, 12, 24, 48, 96, and 384 wells can be used in the SPECTRAmax GEMINI XS. The SpectraMax® M5 Multi-Mode Microplate Reader delivers single mode reader performance and can be equipped to read volumes as low as 2uL in one multimode reader package. Place the microplate on or remove it from the microplate drawer. Robust, high-value microplate readers that can run samples based on pre-defined protocols and standard filter modes cover the entire visible range for a variety of assays. Read one sample or up to 384 in a single plate read using any standard cuvette, 12 x 75 mm test tube, or 96- or 384-well microplate. No accessories are needed and SoftMax® Pro Software. Key features 4 gain calibration failed. The . Temperature control. ) 8. The SpectraMax M2e are multidetection microplate readers with dual-monochromators, dual-mode cuvette ports, and top- and bottom-reading capability. Molecular Devices SpectraMax i3 Multi-Mode Microplate Reader Pred i3x - AV $14,995. Detection cartridge modularity allows for easy addition of new read modes within minutes without. Products : General, Microplate Readers. The SpectraMax ® M3, M4, M5, and M5 e Microplate Readers are a series of dual-monochromator, multidetection, multi-mode instruments with a triple-mode cuvette port and 6-well to 384-well microplate reading capability. Table 2. The SpectraMax® and VersaMax™ require proper ventilation to keep their internal components cool. The SpectraMax® iD3 Multi-Mode Microplate Reader is the cornerstone of a complete laboratory solution designed to expand the boundaries of research capabilities. Shaker time 0 to 999 seconds Temperature control Ambient. SoftMax Pro. Learn how to operate the VersaMax, SpectraMax 340PC384 and SpectraMax 190 Plus384 microplate readers, which offer fast and accurate absorbance measurements for a variety of assays. Other technologies such as imaging. Biocompare is the leading resource for up-to-date product information, product reviews, and new technologies for life scientists. The 1/absorptivity value for double stranded DNA at 260 nm is commonly assumed. Page 14: Component Description† Bottom mounting for SpectraMax Paradigm Readers only. 3) This warranty covers the SPECTRAmax PLUS 384MOLECULAR DEVICES SPECTRA max PLUS 384 Microplate Reader from Bid On Equipment. spr * SpectraMax i3(x) SpectraTest ABS2 v1. Standard features include a cuvette port, spectral scanning in 1 nm increments, and up to six wavelengths per read. For valuable samples and higher-throughput requirements, the assays can be performed in 384-well microplates. If using test tubes, read the absorbance of each tube in the cuvette port of the SPECTRAmax PLUS microplate spectrophotometer. Features. 2 only) SpectraMax M-series Microplate readers. TheSpectraMax®340PC384,SpectraMax®190,andVersaMax™microplate spectrophotometersproviderapidandsensitivemeasurementsofavarietyofanalytesacross awiderangeofconcentrations. Fluorescent detection is achieved from the top, through the entire depth of sample in the microplate well. 1. For more information, please visit us at SpectraMax® M2/M2e microplate readers for use with the Transcreener® FI Assays. 313 reference gain check fail. ) 8. Learn how to operate the VersaMax, SpectraMax 340PC384 and SpectraMax 190 Plus384 microplate readers, which offer fast and accurate absorbance measurements for a. SoftMax Pro Software, the industry-leading microplate reader software for the SpectraMax Plus 384 system, allows complete customization of data collection and. 美谷分子 SpectraMax Plus 384 微孔板读 板机对于进行葡萄酒中苹果酸的酶学定量 检测是很好的一个选择，也可以扩展到类 似的实验，包括氨和挥发性酸度的测定。 这对于花费和时间都是高效的。 SpectraMax Plus 384 微孔板读板机的可 调谐和光径检测传感器特性有助于. With optimized reagents, option to operate the. The SpectraMax® absorbance spectrophotometers and plate readers provide the versatility and convenience for a wide range of assays such as ELISAs, nucleic acid and protein quantitation, and microbial growth. Read one sample or up to 384 in a single plate eead using any standard cuvette, or 96-or 384-well microplate. The value for 1000 should be higher than the value for 900. Detection modalities include absorbance (UV-Vis. Get the best deals for spectramax plus 384 at eBay. Note: for SpectraMax microplate readers without a cuvette port, the water constant is automatically used in PathCheck calculations, and no Water Constant option appears in the Instrument Settings. Theseinstrumentsmeasuretheopticaldensity(OD)ofsamplesatselected wavelengthsinasinglereadmode. For 40 years, we have partnered with scientists to help them achieve landmark discoveries. The optical performance is comparable to a top-of-the-line dedicatedUnparalleled performance on a personalized platform. Temperature control and shaking included as standard. Download PDF versions of the SpectraMax Microplate Reader User Guides. In addition, the iD5 reader measures TRF and FP and can be expanded to include TR-FRET, HTRF®, BRET, dual luciferase reporter assays with injectors, and western blot detection. Products : FlexStation 3 reader, SpectraMax M5/M5e reader, SpectraMax M2/M2e reader. The Molecular Devices SpectraMax 384 Plus is a UV/Vis spectrophotometer and microplate reader combination for more reliable and fast data reporting with built-in cuvette port and microplate drawer. The SpectraMax 340PC384 system has a monochromator instead of interference filters. The SpectraMax® M3 Microplate Reader is the standard for UV/visible multi-mode reader absorbance, providing ultrafast, full spectral range detection for cuvettes and 6-, 12-, 24-, 48-, 96-, and 384-well microplates. View the LabX ads below to find Molecular Devices SpectraMAX plate readers for sale and. Time Resolved Fluorescence. SpectraMax ® Plus 384 optics. 304 signal level saturation. The PathCheck sensor can extend the instrument linearity by a factor of three or more. Products : SpectraMax M2/M2e reader, SpectraMax M5/M5e reader, Gemini XPS reader, SpectraMax Plus 384 reader, SpectraMax 190 reader, VersaMax reader, FlexStation 3 reader I need to reinstall the USB driver for my plate reader. The SpectraMax M5e Micoplate Reader is the standard for UV/Visible multi-mode reader absorbance, providing ultrafast, full spectral range detection for cuvettes, 96-well and 384-well microplates. This kit is optimized for Molecular DevicesMolecular Devices Microplate Reader Spectramax 384 340PC. The SpectraMax i3x reader measures spectral-based absorbance, fluorescence, and luminescence with the added functionality of modular upgrades for western blot, imaging, and fast kinetics with injectors. When reading optical density at wavelengths below 340 nm, special UVtransparent, disposableFor SpectraMax ABS Plus reader, r 2 = 0. Molecular Devices SpectraMax 384 Plus Microplate Reader Specifications. With three modes of detection for full spectrum absorbance, fluorescence and luminescence, It is user upgradeable from 2 to 3 modes. E = absorptivity (extinction coefficient) C = concentration = pathlength. formats from 6- to 384-wells, the SpectraMax iD3 reader is the complete solution for all your research needs. The Analyst®, FlexStation® and SpectraMax® M5/M5 e from Molecular Devices have received the LanthaScreen® Certified designation from Life Technologies which ensures that these readers are validated to strict standards in instrument setup and assay performance. 과 같은 Parameter를 검사하여 평가할 수 있습니다. Digital controller and display. Other recommended products. ® reader to the computer. Wavelength Range. 305 reference level saturation. Wavelength range: Excitation: 250-850 nm, Emission: 360-850 nm. 2) All labor charges to repair the product for a period of one (1) year from the original date of delivery will be paid by Molecular Devices Corporation. . It measures the optical density (OD) of samples in both 96- and 384-well microplates or in a cuvette at a selected wavelength for a single point in time (endpoint), over a specified period of time (kinetic), or over a selected. Wavelength Selection: Monochromator, tunable 1. The SpectraMax® Plus 384 Microplate Reader from Molecular Devices can run both standard spectrophotometer and microplate reader applications on the same instrument. A microplate reader that can detect two or more applications is considered a multi-mode plate reader. Detection modalities are shown in Table 1-1. SpectraMax Plus 384 Spectrophotometer from Molecular Devices LLC. GETTING THE MOST FROM YOUR MOLECULAR DEVICES MICROPLATE SYSTEMS applications guide to microplate systems applications guide to microplate systemsSPECTRAmax PLUS 384 Microplate Spectrophotometer Operator’s Manual 1-3 Introduction General Overview The SPECTRAmax™ PLUS 384 microplate spectrophotometer provides rapid and sensitive UV/VIS measurements of a variety of analytes including specific proteins, nucleic acids, and other molecules across a wide range of concentra-tions. 96 wells 384 wells Absorbance 0:30 1:40 Fluorescence intensity 0:25 1:25 Luminescence 0:30 1:15. Total volume (except deep. The optical system of SpectraMax Plus384 Microplate Reader is built around a monochromator, which allows for selection of up to six wavelengths at a time for absorbance detection in the UV-visible wavelength range (190 nm - 1000 nm). In this product video, see how the SpectraMax M5 quickly reads samples. Which SpectraMax Multi-Mode Microplate Reader do you need? Detection Modes Absorbance Fluorescence Intensity Luminescence Time-Resolved Fluorescence Fluorescence Polarization HTRF Upgrade Options Plate Formats 6-, 12-, 24-, 48-, 96-, 384-Well Microplates Certification and Validation IMAP Validation (TR-FRET only) (TR-FRET. 2. BOE offers an extensive inventory of competitively priced Lab Equipment. 100 fmol 384-well (75 µL) 0. Shaker Time: 0 to 999 seconds: Temperature Range. The minimum order for this item is . SpectraMax® Plus 384 microplate reader can run both standard spectrophotometer and microplate reader applications on the same instrument. SpectraMax190reads96-wellplates. Clearance . Each sample has a discrete sample beam and reference beam. The eight-channel system delivers both high precision and speed when reading 96- and 384-well microplates for endpoint measurements, kinetic assays, and spectral scans. 313 reference gain check fail. Detection modalities are shown in Table 1-1. Molecular Devices, LLC. Multimode Reader Comparison Chart. SpectraMaxi3xMulti-ModeDetectionPlatformUserGuide 26 5039228DOther things to consider include plate format – 96-well and 384-well plates are the norm but higher and lower capacity plate sizes are also available, speed and throughput needed, type of software, and whether or not multiple plates or wells can be read simultaneously. Key applications**. Key features 4 wells: 76 seconds Luminescence Specifications Dynamic Range < 6 decades Sensitivity 10 amol ATP General Specifications. 384 wells) and the "Select Specific" menu to choose the specific plate type. SpectraMax 340PC 384 and SpectraMax Plus 384 read both 96-and 384-well microplates. 5 pM 384-well (50 µL) 6 pM 10 pM 1536-well (8 µL) 19 pM 25 pM 0200-7015 (LUM 384) Optimized Guaranteed* 96-well (200 µL) 1. With optimized reagents, option to operate the readers. Each SpectraMax® 340 PC 384 Microplate Reader has an. Molecular Devices also offers a mass spectrometry-based solution for food safety testingThe SPECTRAmax™ GEMINI XS Dual-Scanning Microplate Spectrofluorometer. SpectraMax® Gemini™ EM Microplate Reader, Molecular Devices. These instruments measure the optical density (OD) of samples at selected wavelengths in a single read mode. The SpectraMax iD3 reader is fully compatible with the SpectraDrop™ Micro Volume Microplate, enabling quantitation of precious low volume samples. SoftMax® Pro Software is included and enables data visualized in 3D plots, gray scale, kinetic curve. The AquaMax® Microplate Washer is a fully self-contained system, configurable for both 96- and 384-well microplates. The reader adds up to three transfers of assay reagents from a 96- or 384-well source plate to enhance assay design using integrated fluidics. SpectraMax® Plus 384 provides ultrafast, full spectral range detection for cuvettes, 96-well, and 384-well microplates, with the only temperature-independent method for pathlength correction. For fluorescence intensity assays, the SpectraMax® M2 and M2e units feature an. Explore how the SpectraMax i3 Multi-Mode Platform provides an unlimited breadth of application possibilities, and how it can evolve with your future needs. For the SpectraMax Plus 384 you can do fixed point cuvette reads. Page 13: Introduction Microplates having 6, 12, 24, 48, 96, and 384 wells can be used in the SpectraMax GEMINI EM. The dual monochromator optics allow the widest range of applications to be utilized for bioresearch and drug discovery applications, all without the need to change. Review date: 12 Jun 2017 | SpectraMax Plus 384 Microplate Reader Get absorbance measurements from 190 to 1000 nm quickly for samples in test tubes, cuvettes, and 96- or 384-well microplates. Create custom fluorescence assays without having to purchase expensive filter sets. 312 gain calibration failed. 96-well Half Area 384- Low Volume 1536- Microplate Material 96-well Stripwell 96-well well 384-well well Clear polystyrene n n n n Solid black or white polystyrene n n n n n n Clear bottom black or white polystyrene n n n n n Polypropylene n n n Solid black or white polypropylene n n*SpectraMax Paradigm Multi-Mode Detection Platform User Guide Loading and Unloading Microplates To load or unload a microplate: 1. Top or bottom detection is available at the touch of a button. The SpectraMax® M2 and M2e Systems from Molecular Devices are multi-detection microplate readers with dual-. and detection of plate formats from 6- to 384-wells, the SpectraMax iD5 reader is the complete solution for all your research needs. The Molecular Devices SpectraMax M3 Multi-Mode Microplate Reader is a dual-monochromator, multi-detection microplate reader with full spectral range detection for cuvettes and 6-, 12-, 24-, 48-, 96-, and 384-well. By utilizing the optimized instrument settings suggested within this Application Note, Z' values > 0. The plate reader optics are. The SpectraMax® iD5 Multi-Mode Microplate Reader is the complete laboratory solution to help you increase your research capabilities and comes with built-in. SpectraMax ® Plus 384 optics. We would like to show you a description here but the site won’t allow us. The SpectraMax® absorbance spectrophotometers and plate readers provide the versatility and. This UV-visible absorbance microplate reader provides ultrafast, full spectral range detection for cuvettes, 96-well, and 384-well microplates, with the only temperature-independent method for pathlength correction. 304 signal level saturation. The SpectraMax ® M3, M4, M5, and M5 e Microplate Readers are a series of dual-monochromator, multidetection, multi-mode instruments with a triple-mode cuvette port and 6-well to 384-well microplate reading capability. The SpectraMax Plus 384 Microplate Reader gives users the convenience of both standard spectrophotometer and microplate reader applications on the same instrument. SpectraMax340PC384reads96-wellplatesand384-wellplates. SpectraMax and VersaMax Plate Readers Operator’s Manual — 0112-0126 Rev A SpectraMax Plus384 SpectraMax 190 SpectraMax 340PC384 VersaMax Microplate Spectrophotometer Operator's Manual Molecular Devices Corporation 1311 Orleans Drive Sunnyvale, California 94089 Part # 0112-0126 Rev A. Detection modalities are shown in Table 1-1. SpectraMax 340PC 384 and SpectraMax Plus 384 read both 96-and 384-well microplates. <p>384-well transparent tissue-culture treated (TC-treated) microplate for cell-based absorbance (colorimetric) assays. Model: SpectraMax PLUS 384. Molecular Devices’ SpectraMax® Plus 384 Microplate Reader provides fast and reliable full spectral range detection for cuvettes, 96-well and 384-well microplates. Users can password-protect data, choose from nine different curve-fitting routines and use default data reduction, or set up custom formulas for analysis. 0. Assay setup for a 384-well low-volume plate. , FI 45 sec. Molecular Devices SpectraMax 384 Plus Microplate Reader Specifications. microplates or in a cuvette at a. The optical system of the SpectraMax 190 Microplate Reader is built around a monochromator, which allows for selection of up to six wavelengths at a time for absorbance detection in the UV-visible wavelength range (190 nm - 850 nm). Multichannel optical design. SpectraMax® Plus 384 microplate reader can run both standard spectrophotometer and microplate reader applications on the same instrument. 3) This warranty covers the SPECTRAmax PLUS 384The SpectraMax 384 Plus UV/Vis Microplate Reader is manufactured by Molecular Devices. SpectraMax iD3 reader with touchscreen and inserted USB flash drive.